Structure
Features extracted based on 3D protein structures (or PDB files) are informative to characterise proteins. After loads of protein structures predicted by AlphaFold, AlphaFold2, and AlphaFold3 are made available online, the functions embedded in computational tools to access these structural features are necessary.
Warning
PyPropel is endeavouring to make the extraction of more structure-based features available. Currently, we include relative solvent accessibility (RSA) by DSSP and encoded sequences by the 3di technique.
Relative solvent accessibility¶
Here, we take six proteins as an example to generate their RSA files using DSSP. It can be done as follows.
Python
1 2 3 4 5 6 | |
Python
1 2 3 4 5 6 7 8 9 10 | |
Then, we can access the RSA file of each protein.
Python
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 | |
Output
No.1: protein: 3pux chain: G
rsa_fas_id rsa_pdb_ids rsa_prob
0 1 2 1.000000
1 2 3 0.829787
2 3 4 1.000000
3 4 5 0.696970
4 5 6 0.705882
.. ... ... ...
288 289 292 1.000000
289 290 293 0.547619
290 291 294 0.394366
291 292 295 1.000000
292 293 296 1.000000
[293 rows x 3 columns]
No.2: protein: 3rko chain: A
rsa_fas_id rsa_pdb_ids rsa_prob
0 1 15 1.000000
1 2 16 0.695431
2 3 17 0.528302
3 4 18 0.668639
4 5 19 0.690355
.. ... ... ...
90 91 122 0.018868
91 92 123 0.682927
92 93 124 0.687117
93 94 125 0.731278
94 95 126 0.823944
[95 rows x 3 columns]
No.3: protein: 3udc chain: A
rsa_fas_id rsa_pdb_ids rsa_prob
0 1 13 1.000000
1 2 14 0.760736
2 3 15 0.804734
3 4 16 0.556098
4 5 17 0.650943
.. ... ... ...
262 263 275 0.974522
263 264 276 0.969543
264 265 277 0.917073
265 266 278 0.911290
266 267 279 1.000000
[267 rows x 3 columns]
No.4: protein: 3vr8 chain: D
rsa_fas_id rsa_pdb_ids rsa_prob
0 1 28 1.000000
1 2 29 0.861538
2 3 30 0.915094
3 4 31 0.933962
4 5 32 0.985915
.. ... ... ...
124 125 152 0.468085
125 126 153 0.570423
126 127 154 0.863436
127 128 155 0.804124
128 129 156 1.000000
[129 rows x 3 columns]
No.5: protein: 4kjs chain: A
rsa_fas_id rsa_pdb_ids rsa_prob
0 1 4 0.840237
1 2 5 0.456853
2 3 6 0.720812
3 4 7 0.698225
4 5 8 0.408537
.. ... ... ...
315 316 347 0.380952
316 317 348 0.035533
317 318 349 0.461929
318 319 350 0.798780
319 320 351 0.756098
[320 rows x 3 columns]
No.6: protein: 4pi2 chain: C
rsa_fas_id rsa_pdb_ids rsa_prob
0 1 16 0.938144
1 2 17 0.561538
2 3 18 0.211268
3 4 19 0.676056
4 5 20 0.441718
.. ... ... ...
223 224 252 0.556098
224 225 253 0.695122
225 226 254 0.914634
226 227 255 0.732394
227 228 256 0.958763
[228 rows x 3 columns]
3di encoded sequence¶
3Di-encoded sequences refer to sequences encoded with 3D structural information of biomolecules, often proteins, to integrate their three-dimensional spatial features into a simplified format suitable for computational analysis, such as machine learning.
This encoding bridges the gap between a protein's primary sequence (linear amino acid sequence) and its three-dimensional conformation (folded structure). The goal of 3Di encoding is to capture spatial relationships, structural motifs, and functional regions that are critical for biological activity.
Includes 3D spatial features derived from the protein's folded structure, typically obtained from crystallography, NMR, or computational modeling (e.g. Angles and torsions: Phi (ϕ), Psi (ψ), and Omega (ω) angles).
Here, we take 3 proteins as an example to generate their 3di.
Python
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 | |
Output
No.1: protein: 1aij chain: L
{'1aij': {'L': {'state': masked_array(data=[--, 2, 2, 12, 12, 5, 12, 17, 9, 9, 2, 0, 2, 9, 0, 12, 12, 2, 5, 1, 12, 13, 15, ..., 12, 14, --],
mask=[ True, False, False, False, False, False, False, False,
False, False, False, False, ..., False, False, False, True],
fill_value=2,
dtype=uint8), 'encoded_sequence': 'DDDPPGPVLLDADLAPPDGCPQSQADVPHRAGPLNVQLVVLVVVLVVLLVVLCVVVPHDDQQPRKQAAAPCVQFPHADDSNRHNSVVSSVVSVLRNQLSVLVSLSSVCSSVVHDSLPSVLSVLVSVLLCLQQPLLSVLLRHRRSHFMDGDVRSVVSVVVLCPQQPNVCLQVLLVLLVVLVVVLVVLVVLVVVLQVCQQPPPPPDDRHDQVVSQVVCCVVPNGDCGPVRSVVSNSVSNSSSSVSSSVSSSCDNNVDRHRSVVVVCVVCCPPPNVPDDDDPRD'}}}
No.2: protein: 1aig chain: L
{'1aig': {'L': {'state': masked_array(data=[--, 2, 2, 12, ..., 2, 2, 11, --],
mask=[ True, False, False, ..., False, False, False,
True],
fill_value=2,
dtype=uint8), 'encoded_sequence': 'DDDPPCVVLLDADQADPDHCPQQDDDVPHGQGPLNVQLVVLVVVLVVLLVVQCVVVPHDDQQPSKQAAADPVCWADADDPNNHRSSVSSVVSVLSNQLSVLVVVSSVCRSVVHDSPVSVLSVLVSVLQCLQQPVLSVLLGHNRSHFMPGDVRSVVSVVVQCPLQPNVCLQVLLVVLVVLVVVLVVLVVVVVVLQCCQQVPPPPDDRHDQVVSQVVCCVVPVGDCGPVSSVVSNSCSSSSSSVSNSVSVSCEPRVDRHRSVVVCCCVQCVPPNNPDDDDDND'}}}
No.3: protein: 1xqf chain: A
{'1xqf': {'A': {'state': masked_array(data=[--, 0, 0, ..., 14, 7,
5, 2, --],
mask=[ True, False, False, ..., False,
False, True],
fill_value=2,
dtype=uint8), 'encoded_sequence': 'DAADVQLQVLLVVLLVLLLLLQVPQLLLQLLQQDDVVQNVQLVVLLVVVLVVLLVVLQQAQVQFQAACDAQFTHDRPQGNHPPQDQRDDDPRHGVVSVSSNVSSLLSVLLSLQSSVCSVWWDSVLSVLLSVLCSVQALRRLSCNCPRPHVLVVLQAFFQQCLLNRQQLSLLLNVVVVVCHNHLVSSVVSLVSNLRSLLSRQLCSVSGPDVLSVQLNLLLVQLLVLQLVLQQVVCCVPVVGGDSVSSSQSSLQSSSLCRRARSWAGSVLSNVSSNVSSNQLNVQLVVVSSVSSSSNRSSLSSLQSNLPGSPVVNGTVHGPPPDDSVSNNVSSVVSSVVSNVSSNVSSVVSSVVSCVPPRIGDD'}}}